Class a: All alpha proteins [46456] (286 folds) |
Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) automatically mapped to Pfam PF07749 |
Family a.71.1.0: automated matches [254218] (1 protein) not a true family |
Protein automated matches [254498] (1 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255078] (4 PDB entries) |
Domain d2c1ya1: 2c1y A:146-253 [129647] Other proteins in same PDB: d2c1ya2 automated match to d1ovna1 mutant |
PDB Entry: 2c1y (more details), 2.25 Å
SCOPe Domain Sequences for d2c1ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1ya1 a.71.1.0 (A:146-253) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtktape
Timeline for d2c1ya1: