Lineage for d2c1ya1 (2c1y A:146-252)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643952Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 643953Superfamily a.71.1: ERP29 C domain-like [47933] (1 family) (S)
  5. 643954Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins)
  6. 643958Protein Windbeutel, C-terminal domain [101269] (1 species)
  7. 643959Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries)
  8. 643966Domain d2c1ya1: 2c1y A:146-252 [129647]
    Other proteins in same PDB: d2c1ya2
    automatically matched to d1ovna1
    mutant

Details for d2c1ya1

PDB Entry: 2c1y (more details), 2.25 Å

PDB Description: structure of pdi-related chaperone, wind mutant-y55k
PDB Compounds: (A:) windbeutel protein

SCOP Domain Sequences for d2c1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ya1 a.71.1.1 (A:146-252) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtktap

SCOP Domain Coordinates for d2c1ya1:

Click to download the PDB-style file with coordinates for d2c1ya1.
(The format of our PDB-style files is described here.)

Timeline for d2c1ya1: