Lineage for d2c1ya1 (2c1y A:146-253)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717770Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 2717771Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) (S)
    automatically mapped to Pfam PF07749
  5. 2717785Family a.71.1.0: automated matches [254218] (1 protein)
    not a true family
  6. 2717786Protein automated matches [254498] (1 species)
    not a true protein
  7. 2717787Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255078] (4 PDB entries)
  8. 2717792Domain d2c1ya1: 2c1y A:146-253 [129647]
    Other proteins in same PDB: d2c1ya2
    automated match to d1ovna1
    mutant

Details for d2c1ya1

PDB Entry: 2c1y (more details), 2.25 Å

PDB Description: structure of pdi-related chaperone, wind mutant-y55k
PDB Compounds: (A:) windbeutel protein

SCOPe Domain Sequences for d2c1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ya1 a.71.1.0 (A:146-253) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtktape

SCOPe Domain Coordinates for d2c1ya1:

Click to download the PDB-style file with coordinates for d2c1ya1.
(The format of our PDB-style files is described here.)

Timeline for d2c1ya1: