Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
Superfamily d.294.1: EndoU-like [142877] (3 families) similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
Family d.294.1.1: Eukaryotic EndoU ribonuclease [142878] (2 proteins) PfamB PB010233; common fold decorated with additional structures automatically mapped to Pfam PF09412 |
Protein EndoU [142879] (1 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [142880] (1 PDB entry) Uniprot Q8JFY9 6-289 |
Domain d2c1wa1: 2c1w A:6-289 [129644] Other proteins in same PDB: d2c1wb_, d2c1wc_ complexed with po4 |
PDB Entry: 2c1w (more details), 2.2 Å
SCOPe Domain Sequences for d2c1wa1:
Sequence, based on SEQRES records: (download)
>d2c1wa1 d.294.1.1 (A:6-289) EndoU {African clawed frog (Xenopus laevis) [TaxId: 8355]} gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvpagsnqardsasfplfqfvde eklksrktfatfislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrk nqakptrndfkvqlyniwfqlysrapgsrpdscgfehvfvgeskrgqemmglhnwvqfyl qekrknidykgyvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytiv flasqekmsrevvrleeyelqivvnrhgryigtaypvllstnnp
>d2c1wa1 d.294.1.1 (A:6-289) EndoU {African clawed frog (Xenopus laevis) [TaxId: 8355]} gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvsasfplfqfvdeeklksrktf atfislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrknqakptrnd fkvqlyniwfqlysrgsrpdscgfehvfvgeskrgqemmglhnwvqfylqekrknidykg yvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytivflasqekmsre vvrleeyelqivvnrhgryigtaypvllstnnp
Timeline for d2c1wa1: