SCOPe 2.08: Domain d2c1wa1: 2c1w A:6-289

Lineage for d2c1wa1 (2c1w A:6-289)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.1: Eukaryotic EndoU ribonuclease [142878] (2 proteins)
   PfamB PB010233; common fold decorated with additional structures
   automatically mapped to Pfam PF09412

6. Protein EndoU [142879] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [142880] (1 PDB entry)
   Uniprot Q8JFY9 6-289

8. Domain d2c1wa1: 2c1w A:6-289 [129644]
   Other proteins in same PDB: d2c1wb_, d2c1wc_
   complexed with po4

Details for d2c1wa1

PDB Entry: 2c1w, 2.2 Å

PDB Description: the structure of xendou: a splicing independent snorna processing endoribonuclease

PDB Compounds: (A:) endou protein

SCOPe Domain Sequences for d2c1wa1:

Sequence, based on SEQRES records:

>d2c1wa1 d.294.1.1 (A:6-289) EndoU {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvpagsnqardsasfplfqfvde
eklksrktfatfislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrk
nqakptrndfkvqlyniwfqlysrapgsrpdscgfehvfvgeskrgqemmglhnwvqfyl
qekrknidykgyvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytiv
flasqekmsrevvrleeyelqivvnrhgryigtaypvllstnnp

Sequence, based on observed residues (ATOM records):

>d2c1wa1 d.294.1.1 (A:6-289) EndoU {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvsasfplfqfvdeeklksrktf
atfislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrknqakptrnd
fkvqlyniwfqlysrgsrpdscgfehvfvgeskrgqemmglhnwvqfylqekrknidykg
yvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytivflasqekmsre
vvrleeyelqivvnrhgryigtaypvllstnnp

Timeline for d2c1wa1:

• d2c1wa1 first appeared in SCOP 1.73
  
• d2c1wa1 appears in SCOPe 2.07