SCOPe 2.05: Domain d2c1tb_: 2c1t B:

Lineage for d2c1tb_ (2c1t B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
   this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain

6. Protein automated matches [190070] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187009] (3 PDB entries)

8. Domain d2c1tb_: 2c1t B: [129643]
   automated match to d1un0a_

Details for d2c1tb_

PDB Entry: 2c1t, 2.6 Å

PDB Description: structure of the kap60p:nup2 complex

PDB Compounds: (B:) importin alpha subunit

SCOPe Domain Sequences for d2c1tb_:

Sequence; same for both SEQRES and ATOM records:

>d2c1tb_ a.118.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
yfg

Timeline for d2c1tb_:

• d2c1tb_ first appeared in SCOP 1.73, called d2c1tb1
  
• d2c1tb_ appears in SCOPe 2.04
  
• d2c1tb_ appears in SCOPe 2.06
  
• d2c1tb_ appears in the current release, SCOPe 2.08