Lineage for d2c1ta_ (2c1t A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.1: ARM repeat [48371] (28 families) 
Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
Protein automated matches [190070] (4 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187009] (3 PDB entries) 
Domain d2c1ta_: 2c1t A: [129642]
automated match to d1un0a_
Details for d2c1ta_
PDB Entry: 2c1t (more details), 2.6 Å
PDB Description: structure of the kap60p:nup2 complex
PDB Compounds: (A:) importin alpha subunitSCOPe Domain Sequences for d2c1ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1ta_ a.118.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
yfg
SCOPe Domain Coordinates for d2c1ta_:
Click to download the PDB-style file with coordinates for d2c1ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c1ta_:
- d2c1ta_ first appeared in SCOP 1.73, called d2c1ta1
- d2c1ta_ appears in SCOPe 2.07
View in 3D
