SCOPe 2.07: Domain d2c1nb_: 2c1n B:

Lineage for d2c1nb_ (2c1n B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)

8. Domain d2c1nb_: 2c1n B: [129641]
   automated match to d1qjba_

Details for d2c1nb_

PDB Entry: 2c1n, 2 Å

PDB Description: molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3

PDB Compounds: (B:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d2c1nb_:

Sequence, based on SEQRES records:

>d2c1nb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records):

>d2c1nb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevakgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnsp
ekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Timeline for d2c1nb_:

• d2c1nb_ first appeared in SCOP 1.73, called d2c1nb1
  
• d2c1nb_ appears in SCOPe 2.06
  
• d2c1nb_ appears in the current release, SCOPe 2.08