![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.341: Peptidoglycan deacetylase N-terminal noncatalytic region [144014] (1 superfamily) consists of two different domains, d1: [alpha-beta(2)-alpha-beta(3); 3 layers: a/b/a; mixed beta-sheet, order 12345, strands 2 and 3 are parallel to each other with a left-handed crossover connection], d2: alpha-beta(3)-alpha; 2 layers; antiparallel beta-sheet, order 123] |
![]() | Superfamily d.341.1: Peptidoglycan deacetylase N-terminal noncatalytic region [144015] (1 family) ![]() |
![]() | Family d.341.1.1: Peptidoglycan deacetylase N-terminal noncatalytic region [144016] (1 protein) |
![]() | Protein Peptidoglycan GlcNAc deacetylase [144017] (1 species) |
![]() | Species Streptococcus pneumoniae [TaxId:1313] [144018] (2 PDB entries) |
![]() | Domain d2c1ia2: 2c1i A:46-267 [129637] Other proteins in same PDB: d2c1ia1 complexed with mes, so4, zn; mutant |
PDB Entry: 2c1i (more details), 1.35 Å
SCOP Domain Sequences for d2c1ia2:
Sequence, based on SEQRES records: (download)
>d2c1ia2 d.341.1.1 (A:46-267) Peptidoglycan GlcNAc deacetylase {Streptococcus pneumoniae [TaxId: 1313]} feqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissvrelinqdvkdkle skdnlvfyyteqeesglkgvvnrnvtkqiydlvafkieetektslgkvhltedgqpftld qlfsdaskakeqlikeltsfiedkkieqdqseqivknfsdqdlsawnfdykdsqiilyps pvvenleeialpvsaffdviqssyllekdaalyqsyfdkkhq
>d2c1ia2 d.341.1.1 (A:46-267) Peptidoglycan GlcNAc deacetylase {Streptococcus pneumoniae [TaxId: 1313]} feqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissvrelinqdvkdkle skdnlvfyyteqeesglkgvvnrnvtkqiydieetektslgkvhltedgqpftldqlfsd askakeqlikeltsfdlsawnfdykdsqiilyeialpvsaffdviqssyllekdaalyqs yfdkkhq
Timeline for d2c1ia2: