Lineage for d2c1ia2 (2c1i A:46-267)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011263Fold d.341: Peptidoglycan deacetylase N-terminal noncatalytic region [144014] (1 superfamily)
    consists of two different domains, d1: [alpha-beta(2)-alpha-beta(3); 3 layers: a/b/a; mixed beta-sheet, order 12345, strands 2 and 3 are parallel to each other with a left-handed crossover connection], d2: alpha-beta(3)-alpha; 2 layers; antiparallel beta-sheet, order 123]
  4. 3011264Superfamily d.341.1: Peptidoglycan deacetylase N-terminal noncatalytic region [144015] (1 family) (S)
  5. 3011265Family d.341.1.1: Peptidoglycan deacetylase N-terminal noncatalytic region [144016] (1 protein)
  6. 3011266Protein Peptidoglycan GlcNAc deacetylase [144017] (1 species)
  7. 3011267Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [144018] (2 PDB entries)
    Uniprot Q8DP63 46-267
  8. 3011268Domain d2c1ia2: 2c1i A:46-267 [129637]
    Other proteins in same PDB: d2c1ia1
    complexed with mes, so4, zn; mutant

Details for d2c1ia2

PDB Entry: 2c1i (more details), 1.35 Å

PDB Description: structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) d 275 n mutant.
PDB Compounds: (A:) peptidoglycan glcnac deacetylase

SCOPe Domain Sequences for d2c1ia2:

Sequence, based on SEQRES records: (download)

>d2c1ia2 d.341.1.1 (A:46-267) Peptidoglycan GlcNAc deacetylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
feqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissvrelinqdvkdkle
skdnlvfyyteqeesglkgvvnrnvtkqiydlvafkieetektslgkvhltedgqpftld
qlfsdaskakeqlikeltsfiedkkieqdqseqivknfsdqdlsawnfdykdsqiilyps
pvvenleeialpvsaffdviqssyllekdaalyqsyfdkkhq

Sequence, based on observed residues (ATOM records): (download)

>d2c1ia2 d.341.1.1 (A:46-267) Peptidoglycan GlcNAc deacetylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
feqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissvrelinqdvkdkle
skdnlvfyyteqeesglkgvvnrnvtkqiydieetektslgkvhltedgqpftldqlfsd
askakeqlikeltsfdlsawnfdykdsqiilyeialpvsaffdviqssyllekdaalyqs
yfdkkhq

SCOPe Domain Coordinates for d2c1ia2:

Click to download the PDB-style file with coordinates for d2c1ia2.
(The format of our PDB-style files is described here.)

Timeline for d2c1ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c1ia1