SCOP 1.73: Domain d2c1ia1: 2c1i A:268-463

Lineage for d2c1ia1 (2c1i A:268-463)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (6 proteins)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456

6. Protein Peptidoglycan GlcNAc deacetylase C-terminal domain [141959] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [141960] (2 PDB entries)

8. Domain d2c1ia1: 2c1i A:268-463 [129636]
   Other proteins in same PDB: d2c1ia2
   complexed with mes, so4, zn; mutant

Details for d2c1ia1

PDB Entry: 2c1i, 1.35 Å

PDB Description: structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) d 275 n mutant.

PDB Compounds: (A:) peptidoglycan glcnac deacetylase

SCOP Domain Sequences for d2c1ia1:

Sequence; same for both SEQRES and ATOM records:

>d2c1ia1 c.6.2.3 (A:268-463) Peptidoglycan GlcNAc deacetylase C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
kvvaltfndgpnpattpqvletlakydikatffvlgknvsgnedlvkrikseghvvgnhs
wshpilsqlsldeakkqitdtedvltkvlgsssklmrppygaitddirnsldlsfimwdv
dsldwkskneasilteiqhqvangsivlmhdihsptvnalprvieylknqgytfvtipem
lntrlkahelyysrde

Timeline for d2c1ia1:

• d2c1ia1 is new in SCOP 1.73
  
• d2c1ia1 appears in SCOP 1.75
  
• d2c1ia1 appears in the current release, SCOPe 2.08