Lineage for d2c1hb1 (2c1h B:10-328)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 684374Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 684375Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 684402Species Prosthecochloris vibrioformis [TaxId:1098] [110362] (2 PDB entries)
  8. 684404Domain d2c1hb1: 2c1h B:10-328 [129635]
    automatically matched to d1w1za_
    complexed with dsb, mg

Details for d2c1hb1

PDB Entry: 2c1h (more details), 2.6 Å

PDB Description: the x-ray structure of chlorobium vibrioforme 5-aminolaevulinic acid dehydratase complexed with a diacid inhibitor
PDB Compounds: (B:) delta-aminolevulinic acid dehydratase

SCOP Domain Sequences for d2c1hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1hb1 c.1.10.3 (B:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]}
vhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfrftidravee
ckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelcimtdvaldpf
tpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigairealdetdh
sdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeveldivegadi
vmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvmmesllcmkr
agadiiftyyakeaakklr

SCOP Domain Coordinates for d2c1hb1:

Click to download the PDB-style file with coordinates for d2c1hb1.
(The format of our PDB-style files is described here.)

Timeline for d2c1hb1:

Domains from other chains:
(mouse over for more information)
d2c1ha1