SCOPe 2.08: Domain d2c1hb_: 2c1h B:

Lineage for d2c1hb_ (2c1h B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
   hybrid of classes I and II aldolase
   automatically mapped to Pfam PF00490

6. Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)

7. Species Prosthecochloris vibrioformis [TaxId:1098] [110362] (2 PDB entries)
   Uniprot Q59334

8. Domain d2c1hb_: 2c1h B: [129635]
   automated match to d1w1za_
   complexed with dsb, mg

Details for d2c1hb_

PDB Entry: 2c1h, 2.6 Å

PDB Description: the x-ray structure of chlorobium vibrioforme 5-aminolaevulinic acid dehydratase complexed with a diacid inhibitor

PDB Compounds: (B:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d2c1hb_:

Sequence; same for both SEQRES and ATOM records:

>d2c1hb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]}
vhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfrftidravee
ckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelcimtdvaldpf
tpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigairealdetdh
sdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeveldivegadi
vmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvmmesllcmkr
agadiiftyyakeaakklr

Timeline for d2c1hb_:

• d2c1hb_ first appeared in SCOP 1.73, called d2c1hb1
  
• d2c1hb_ appears in SCOPe 2.07