Lineage for d2c1ha_ (2c1h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835458Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2835459Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 2835490Species Prosthecochloris vibrioformis [TaxId:1098] [110362] (2 PDB entries)
    Uniprot Q59334
  8. 2835491Domain d2c1ha_: 2c1h A: [129634]
    automated match to d1w1za_
    complexed with dsb, mg

Details for d2c1ha_

PDB Entry: 2c1h (more details), 2.6 Å

PDB Description: the x-ray structure of chlorobium vibrioforme 5-aminolaevulinic acid dehydratase complexed with a diacid inhibitor
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d2c1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ha_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]}
vhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfrftidravee
ckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelcimtdvaldpf
tpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigairealdetdh
sdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeveldivegadi
vmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvmmesllcmkr
agadiiftyyakeaakklr

SCOPe Domain Coordinates for d2c1ha_:

Click to download the PDB-style file with coordinates for d2c1ha_.
(The format of our PDB-style files is described here.)

Timeline for d2c1ha_: