SCOPe 2.07: Domain d2c1ga2: 2c1g A:46-267

Lineage for d2c1ga2 (2c1g A:46-267)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.341: Peptidoglycan deacetylase N-terminal noncatalytic region [144014] (1 superfamily)
   consists of two different domains, d1: [alpha-beta(2)-alpha-beta(3); 3 layers: a/b/a; mixed beta-sheet, order 12345, strands 2 and 3 are parallel to each other with a left-handed crossover connection], d2: alpha-beta(3)-alpha; 2 layers; antiparallel beta-sheet, order 123]

4. Superfamily d.341.1: Peptidoglycan deacetylase N-terminal noncatalytic region [144015] (1 family)

5. Family d.341.1.1: Peptidoglycan deacetylase N-terminal noncatalytic region [144016] (1 protein)

6. Protein Peptidoglycan GlcNAc deacetylase [144017] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [144018] (2 PDB entries)
   Uniprot Q8DP63 46-267

8. Domain d2c1ga2: 2c1g A:46-267 [129633]
   Other proteins in same PDB: d2c1ga1
   complexed with act, peg, zn

Details for d2c1ga2

PDB Entry: 2c1g, 1.75 Å

PDB Description: structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda)

PDB Compounds: (A:) peptidoglycan glcnac deacetylase

SCOPe Domain Sequences for d2c1ga2:

Sequence, based on SEQRES records:

>d2c1ga2 d.341.1.1 (A:46-267) Peptidoglycan GlcNAc deacetylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
feqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissvrelinqdvkdkle
skdnlvfyyteqeesglkgvvnrnvtkqiydlvafkieetektslgkvhltedgqpftld
qlfsdaskakeqlikeltsfiedkkieqdqseqivknfsdqdlsawnfdykdsqiilyps
pvvenleeialpvsaffdviqssyllekdaalyqsyfdkkhq

Sequence, based on observed residues (ATOM records):

>d2c1ga2 d.341.1.1 (A:46-267) Peptidoglycan GlcNAc deacetylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
feqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissvrelinqdvkdkle
skdnlvfyyteqeesglkgvvnrnvtkqiydlvafkieetektslgkvhltedgqpftld
qlfsdaskakeqlikeltsfwnfdykdsqiilyeialpvsaffdviqssyllekdaalyq
syfdkkhq

Timeline for d2c1ga2:

• d2c1ga2 first appeared in SCOP 1.73
  
• d2c1ga2 appears in SCOPe 2.06
  
• d2c1ga2 appears in the current release, SCOPe 2.08