Lineage for d2c1ga1 (2c1g A:268-463)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850644Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 2850651Protein Peptidoglycan GlcNAc deacetylase C-terminal domain [141959] (1 species)
  7. 2850652Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141960] (2 PDB entries)
    Uniprot Q8DP63 268-463
  8. 2850654Domain d2c1ga1: 2c1g A:268-463 [129632]
    Other proteins in same PDB: d2c1ga2
    complexed with act, peg, zn

Details for d2c1ga1

PDB Entry: 2c1g (more details), 1.75 Å

PDB Description: structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda)
PDB Compounds: (A:) peptidoglycan glcnac deacetylase

SCOPe Domain Sequences for d2c1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ga1 c.6.2.3 (A:268-463) Peptidoglycan GlcNAc deacetylase C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kvvaltfddgpnpattpqvletlakydikatffvlgknvsgnedlvkrikseghvvgnhs
wshpilsqlsldeakkqitdtedvltkvlgsssklmrppygaitddirnsldlsfimwdv
dsldwkskneasilteiqhqvangsivlmhdihsptvnalprvieylknqgytfvtipem
lntrlkahelyysrde

SCOPe Domain Coordinates for d2c1ga1:

Click to download the PDB-style file with coordinates for d2c1ga1.
(The format of our PDB-style files is described here.)

Timeline for d2c1ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c1ga2