SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2c1ga1 (2c1g A:268-463)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097583Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2097655Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 protein domains)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 2097662Protein Peptidoglycan GlcNAc deacetylase C-terminal domain [141959] (1 species)
  7. 2097663Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141960] (2 PDB entries)
    Uniprot Q8DP63 268-463
  8. 2097665Domain d2c1ga1: 2c1g A:268-463 [129632]
    Other proteins in same PDB: d2c1ga2
    complexed with act, peg, zn

Details for d2c1ga1

PDB Entry: 2c1g (more details), 1.75 Å

PDB Description: structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda)
PDB Compounds: (A:) peptidoglycan glcnac deacetylase

SCOPe Domain Sequences for d2c1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ga1 c.6.2.3 (A:268-463) Peptidoglycan GlcNAc deacetylase C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kvvaltfddgpnpattpqvletlakydikatffvlgknvsgnedlvkrikseghvvgnhs
wshpilsqlsldeakkqitdtedvltkvlgsssklmrppygaitddirnsldlsfimwdv
dsldwkskneasilteiqhqvangsivlmhdihsptvnalprvieylknqgytfvtipem
lntrlkahelyysrde

SCOPe Domain Coordinates for d2c1ga1:

Click to download the PDB-style file with coordinates for d2c1ga1.
(The format of our PDB-style files is described here.)

Timeline for d2c1ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c1ga2