SCOP 1.73: Domain d2c1cb1: 2c1c B:7-309

Lineage for d2c1cb1 (2c1c B:7-309)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)

6. Protein Carboxypeptidase B [53193] (4 species)

7. Species Corn earworm (Helicoverpa zea) [TaxId:7113] [142511] (1 PDB entry)

8. Domain d2c1cb1: 2c1c B:7-309 [129631]
   automatically matched to 2C1C A:7-309
   complexed with y1, zn

Details for d2c1cb1

PDB Entry: 2c1c, 2.3 Å

PDB Description: Structural basis of the resistance of an insect carboxypeptidase to plant protease inhibitors

PDB Compounds: (B:) carboxypeptidase b

SCOP Domain Sequences for d2c1cb1:

Sequence; same for both SEQRES and ATOM records:

>d2c1cb1 c.56.5.1 (B:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]}
lpydnyqelevideyldyigekypdvatvvnaaesfegrpikyikisttnfedenkpvif
idggiharewisppsvtwaihklvedvtendllekfdwillpvvnpdgykytftnerfwr
ktrstnnnplsqicrgadgnrnfdfvwnsigtsnspcsdiyagtsafsevetrvvrdilh
ehlarmalyltmhsfgsmilypwghdgslsqnalglhtvgvamasviqsnalpnfppytv
gnsalvigyyiagssedyahsigvplsytyelpglssgwdgfhlppqyieqvcretwegi
vvgarragdlfr

Timeline for d2c1cb1:

• d2c1cb1 is new in SCOP 1.73
  
• d2c1cb1 appears in SCOP 1.75
  
• d2c1cb1 appears in the current release, SCOPe 2.08, called d2c1cb_