![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
![]() | Protein Carboxypeptidase B [53193] (4 species) |
![]() | Species Corn earworm (Helicoverpa zea) [TaxId:7113] [142511] (1 PDB entry) Uniprot Q3T905 117-428 |
![]() | Domain d2c1cb_: 2c1c B: [129631] automated match to d2c1ca1 complexed with y1, zn |
PDB Entry: 2c1c (more details), 2.3 Å
SCOPe Domain Sequences for d2c1cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1cb_ c.56.5.1 (B:) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} lpydnyqelevideyldyigekypdvatvvnaaesfegrpikyikisttnfedenkpvif idggiharewisppsvtwaihklvedvtendllekfdwillpvvnpdgykytftnerfwr ktrstnnnplsqicrgadgnrnfdfvwnsigtsnspcsdiyagtsafsevetrvvrdilh ehlarmalyltmhsfgsmilypwghdgslsqnalglhtvgvamasviqsnalpnfppytv gnsalvigyyiagssedyahsigvplsytyelpglssgwdgfhlppqyieqvcretwegi vvgarragdlfr
Timeline for d2c1cb_: