SCOPe 2.06: Domain d2c1ca1: 2c1c A:7-309

Lineage for d2c1ca1 (2c1c A:7-309)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase B [53193] (4 species)

7. Species Corn earworm (Helicoverpa zea) [TaxId:7113] [142511] (1 PDB entry)
   Uniprot Q3T905 117-428

8. Domain d2c1ca1: 2c1c A:7-309 [129630]
   complexed with y1, zn

Details for d2c1ca1

PDB Entry: 2c1c, 2.3 Å

PDB Description: Structural basis of the resistance of an insect carboxypeptidase to plant protease inhibitors

PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d2c1ca1:

Sequence; same for both SEQRES and ATOM records:

>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]}
lpydnyqelevideyldyigekypdvatvvnaaesfegrpikyikisttnfedenkpvif
idggiharewisppsvtwaihklvedvtendllekfdwillpvvnpdgykytftnerfwr
ktrstnnnplsqicrgadgnrnfdfvwnsigtsnspcsdiyagtsafsevetrvvrdilh
ehlarmalyltmhsfgsmilypwghdgslsqnalglhtvgvamasviqsnalpnfppytv
gnsalvigyyiagssedyahsigvplsytyelpglssgwdgfhlppqyieqvcretwegi
vvgarragdlfr

Timeline for d2c1ca1:

• d2c1ca1 first appeared in SCOP 1.73
  
• d2c1ca1 appears in SCOPe 2.05
  
• d2c1ca1 appears in SCOPe 2.07
  
• d2c1ca1 appears in the current release, SCOPe 2.08