Lineage for d2c1ba_ (2c1b A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein automated matches [190091] (20 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries)
  8. Domain d2c1ba_: 2c1b A: [129629]
    automated match to d1cmke_
    complexed with cqp

Details for d2c1ba_

PDB Entry: 2c1b (more details), 2 Å

PDB Description: structure of camp-dependent protein kinase complexed with (4r,2s)-5'- (4-(4-chlorobenzyloxy)pyrrolidin-2-ylmethanesulfonyl)isoquinoline
PDB Compounds: (A:) cAMP-DEPENDENT PROTEIN KINASE

SCOPe Domain Sequences for d2c1ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ba_ d.144.1.7 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki
ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlr
rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg
rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d2c1ba_ are not available.

Timeline for d2c1ba_: