| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 protein domains) |
| Protein Nitroalkane oxidase [140471] (1 species) |
| Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries) Uniprot Q8X1D8 261-430 |
| Domain d2c12f1: 2c12 F:261-430 [129626] Other proteins in same PDB: d2c12a2, d2c12b2, d2c12c2, d2c12d2, d2c12e2, d2c12f2 automatically matched to 2C0U A:261-430 complexed with fad, gol, pe4, spm |
| PDB Entry: 2c12 (more details) PDB Description: crystal structure of nitroalkane oxidase in complex with spermine, a competitive inhibitor
PDB Compounds: (F:) nitroalkane oxidaseSCOP Domain Sequences for d2c12f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c12f1 a.29.3.1 (F:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatyg
SCOP Domain Coordinates for d2c12f1:
Click to download the PDB-style file with coordinates for d2c12f1. (The format of our PDB-style files is described here.)
Timeline for d2c12f1:
d2c12f1 appears in SCOP 1.75A | d2c12f1 (click for larger image) d2c12f1 in context of chain Domains from same chain: d2c12f2 d2c12f1 in context of PDB Domains from other chains: d2c12a1, d2c12a2, d2c12b1, d2c12b2, d2c12c1, d2c12c2, d2c12d1, d2c12d2, d2c12e1, d2c12e2 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |