![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
![]() | Protein Nitroalkane oxidase [140471] (1 species) |
![]() | Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (2 PDB entries) Uniprot Q8X1D8 261-430 |
![]() | Domain d2c12d1: 2c12 D:261-431 [129622] Other proteins in same PDB: d2c12a2, d2c12b2, d2c12c2, d2c12d2, d2c12e2, d2c12f2 automated match to d2c0ua1 complexed with fad, gol, pe4, spm |
PDB Entry: 2c12 (more details), 2.07 Å
SCOPe Domain Sequences for d2c12d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c12d1 a.29.3.1 (D:261-431) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]} pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygs
Timeline for d2c12d1: