![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
![]() | Protein Nitroalkane oxidase [144026] (1 species) |
![]() | Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (2 PDB entries) Uniprot Q8X1D8 2-260 |
![]() | Domain d2c12b2: 2c12 B:2-260 [129619] Other proteins in same PDB: d2c12a1, d2c12b1, d2c12c1, d2c12d1, d2c12e1, d2c12f1 automated match to d2c0ua2 complexed with fad, gol, pe4, spm |
PDB Entry: 2c12 (more details), 2.07 Å
SCOPe Domain Sequences for d2c12b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c12b2 e.6.1.1 (B:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]} vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts gphtrftefhvphenllct
Timeline for d2c12b2: