Lineage for d2c12b2 (2c12 B:2-260)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1950935Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1950936Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1950937Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 1951012Protein Nitroalkane oxidase [144026] (1 species)
  7. 1951013Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (2 PDB entries)
    Uniprot Q8X1D8 2-260
  8. 1951019Domain d2c12b2: 2c12 B:2-260 [129619]
    Other proteins in same PDB: d2c12a1, d2c12b1, d2c12c1, d2c12d1, d2c12e1, d2c12f1
    automated match to d2c0ua2
    complexed with fad, gol, pe4, spm

Details for d2c12b2

PDB Entry: 2c12 (more details), 2.07 Å

PDB Description: Crystal Structure of Nitroalkane Oxidase in Complex with Spermine, a Competitive Inhibitor
PDB Compounds: (B:) nitroalkane oxidase

SCOPe Domain Sequences for d2c12b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c12b2 e.6.1.1 (B:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

SCOPe Domain Coordinates for d2c12b2:

Click to download the PDB-style file with coordinates for d2c12b2.
(The format of our PDB-style files is described here.)

Timeline for d2c12b2: