SCOP 1.73: Domain d2c12b2: 2c12 B:2-260

Lineage for d2c12b2 (2c12 B:2-260)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)

6. Protein Nitroalkane oxidase [144026] (1 species)

7. Species Fusarium oxysporum [TaxId:5507] [144027] (2 PDB entries)

8. Domain d2c12b2: 2c12 B:2-260 [129619]
   Other proteins in same PDB: d2c12a1, d2c12b1, d2c12c1, d2c12d1, d2c12e1, d2c12f1
   automatically matched to 2C0U A:2-260
   complexed with fad, gol, pe4, spm

Details for d2c12b2

PDB Entry: 2c12, 2.07 Å

PDB Description: Crystal Structure of Nitroalkane Oxidase in Complex with Spermine, a Competitive Inhibitor

PDB Compounds: (B:) nitroalkane oxidase

SCOP Domain Sequences for d2c12b2:

Sequence; same for both SEQRES and ATOM records:

>d2c12b2 e.6.1.1 (B:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

Timeline for d2c12b2:

• d2c12b2 is new in SCOP 1.73
  
• d2c12b2 appears in SCOP 1.75
  
• d2c12b2 appears in the current release, SCOPe 2.08