| Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 protein domains) |
| Protein Nitroalkane oxidase [144026] (1 species) |
| Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (4 PDB entries) Uniprot Q8X1D8 2-260 |
| Domain d2c12b2: 2c12 B:2-260 [129619] Other proteins in same PDB: d2c12a1, d2c12b1, d2c12c1, d2c12d1, d2c12e1, d2c12f1 automatically matched to 2C0U A:2-260 complexed with fad, gol, pe4, spm |
| PDB Entry: 2c12 (more details) PDB Description: crystal structure of nitroalkane oxidase in complex with spermine, a competitive inhibitor
PDB Compounds: (B:) nitroalkane oxidaseSCOP Domain Sequences for d2c12b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c12b2 e.6.1.1 (B:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct
SCOP Domain Coordinates for d2c12b2:
Click to download the PDB-style file with coordinates for d2c12b2. (The format of our PDB-style files is described here.)
Timeline for d2c12b2:
d2c12b2 appears in SCOP 1.75A | d2c12b2 (click for larger image) d2c12b2 in context of chain Domains from same chain: d2c12b1 d2c12b2 in context of PDB Domains from other chains: d2c12a1, d2c12a2, d2c12c1, d2c12c2, d2c12d1, d2c12d2, d2c12e1, d2c12e2, d2c12f1, d2c12f2 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |