Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2c12a2 (2c12 A:2-260)

  1. Root: SCOP 1.75B
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 protein domains)
  6. Protein Nitroalkane oxidase [144026] (1 species)
  7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (4 PDB entries)
    Uniprot Q8X1D8 2-260
  8. Domain d2c12a2: 2c12 A:2-260 [129617]
    Other proteins in same PDB: d2c12a1, d2c12b1, d2c12c1, d2c12d1, d2c12e1, d2c12f1
    automatically matched to 2C0U A:2-260
    complexed with fad, gol, pe4, spm

Details for d2c12a2

PDB Entry: 2c12 (more details)
PDB Description: crystal structure of nitroalkane oxidase in complex with spermine, a competitive inhibitor
PDB Compounds: (A:) nitroalkane oxidase

SCOP Domain Sequences for d2c12a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

SCOP Domain Coordinates for d2c12a2:

Click to download the PDB-style file with coordinates for d2c12a2.
(The format of our PDB-style files is described here.)

Timeline for d2c12a2:

d2c12a2 appears in SCOP 1.75A


d2c12a2
(click for larger image)


d2c12a2 in context of chain
Domains from same chain:
d2c12a1


d2c12a2 in context of PDB
Domains from other chains:
d2c12b1, d2c12b2, d2c12c1, d2c12c2, d2c12d1, d2c12d2, d2c12e1, d2c12e2, d2c12f1, d2c12f2


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu