SCOPe 2.08: Domain d2c12a1: 2c12 A:261-431

Lineage for d2c12a1 (2c12 A:261-431)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)

6. Protein Nitroalkane oxidase [140471] (1 species)

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (2 PDB entries)
   Uniprot Q8X1D8 261-430

8. Domain d2c12a1: 2c12 A:261-431 [129616]
   Other proteins in same PDB: d2c12a2, d2c12b2, d2c12c2, d2c12d2, d2c12e2, d2c12f2
   automated match to d2c0ua1
   complexed with fad, gol, pe4, spm

Details for d2c12a1

PDB Entry: 2c12, 2.07 Å

PDB Description: Crystal Structure of Nitroalkane Oxidase in Complex with Spermine, a Competitive Inhibitor

PDB Compounds: (A:) nitroalkane oxidase

SCOPe Domain Sequences for d2c12a1:

Sequence; same for both SEQRES and ATOM records:

>d2c12a1 a.29.3.1 (A:261-431) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygs

Timeline for d2c12a1:

• d2c12a1 first appeared in SCOP 1.73
  
• d2c12a1 appears in SCOPe 2.07