Lineage for d2c0ud2 (2c0u D:2-260)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055320Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1055321Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1055322Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)
  6. 1055398Protein Nitroalkane oxidase [144026] (1 species)
  7. 1055399Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (4 PDB entries)
    Uniprot Q8X1D8 2-260
  8. 1055409Domain d2c0ud2: 2c0u D:2-260 [129614]
    Other proteins in same PDB: d2c0ua1, d2c0ub1, d2c0uc1, d2c0ud1
    automatically matched to 2C0U A:2-260
    complexed with fad, nbt

Details for d2c0ud2

PDB Entry: 2c0u (more details), 2.2 Å

PDB Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover
PDB Compounds: (D:) nitroalkane oxidase

SCOPe Domain Sequences for d2c0ud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ud2 e.6.1.1 (D:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

SCOPe Domain Coordinates for d2c0ud2:

Click to download the PDB-style file with coordinates for d2c0ud2.
(The format of our PDB-style files is described here.)

Timeline for d2c0ud2: