Class a: All alpha proteins [46456] (286 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
Protein Nitroalkane oxidase [140471] (1 species) |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (2 PDB entries) Uniprot Q8X1D8 261-430 |
Domain d2c0ud1: 2c0u D:261-431 [129613] Other proteins in same PDB: d2c0ua2, d2c0ub2, d2c0uc2, d2c0ud2 automated match to d2c0ua1 complexed with fad, nbt |
PDB Entry: 2c0u (more details), 2.2 Å
SCOPe Domain Sequences for d2c0ud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ud1 a.29.3.1 (D:261-431) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]} pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygs
Timeline for d2c0ud1: