SCOP 1.73: Domain d2c0ud1: 2c0u D:261-430

Lineage for d2c0ud1 (2c0u D:261-430)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)

6. Protein Nitroalkane oxidase [140471] (1 species)

7. Species Fusarium oxysporum [TaxId:5507] [140472] (2 PDB entries)

8. Domain d2c0ud1: 2c0u D:261-430 [129613]
   Other proteins in same PDB: d2c0ua2, d2c0ub2, d2c0uc2, d2c0ud2
   automatically matched to 2C0U A:261-430
   complexed with fad, nbt

Details for d2c0ud1

PDB Entry: 2c0u, 2.2 Å

PDB Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover

PDB Compounds: (D:) nitroalkane oxidase

SCOP Domain Sequences for d2c0ud1:

Sequence; same for both SEQRES and ATOM records:

>d2c0ud1 a.29.3.1 (D:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatyg

Timeline for d2c0ud1:

• d2c0ud1 is new in SCOP 1.73
  
• d2c0ud1 appears in SCOP 1.75
  
• d2c0ud1 appears in the current release, SCOPe 2.08