Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2c0ud1 (2c0u D:261-430)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 protein domains)
  6. Protein Nitroalkane oxidase [140471] (1 species)
  7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries)
    Uniprot Q8X1D8 261-430
  8. Domain d2c0ud1: 2c0u D:261-430 [129613]
    Other proteins in same PDB: d2c0ua2, d2c0ub2, d2c0uc2, d2c0ud2
    automatically matched to 2C0U A:261-430
    complexed with fad, nbt

Details for d2c0ud1

PDB Entry: 2c0u (more details)
PDB Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover
PDB Compounds: (D:) nitroalkane oxidase

SCOP Domain Sequences for d2c0ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ud1 a.29.3.1 (D:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatyg

SCOP Domain Coordinates for d2c0ud1:

Click to download the PDB-style file with coordinates for d2c0ud1.
(The format of our PDB-style files is described here.)

Timeline for d2c0ud1:

d2c0ud1 appears in SCOP 1.75A


d2c0ud1
(click for larger image)


d2c0ud1 in context of chain
Domains from same chain:
d2c0ud2


d2c0ud1 in context of PDB
Domains from other chains:
d2c0ua1, d2c0ua2, d2c0ub1, d2c0ub2, d2c0uc1, d2c0uc2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu