Lineage for d2c0uc1 (2c0u C:261-431)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1731941Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 1732016Protein Nitroalkane oxidase [140471] (1 species)
  7. 1732017Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (2 PDB entries)
    Uniprot Q8X1D8 261-430
  8. 1732020Domain d2c0uc1: 2c0u C:261-431 [129611]
    Other proteins in same PDB: d2c0ua2, d2c0ub2, d2c0uc2, d2c0ud2
    automated match to d2c0ua1
    complexed with fad, nbt

Details for d2c0uc1

PDB Entry: 2c0u (more details), 2.2 Å

PDB Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover
PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d2c0uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0uc1 a.29.3.1 (C:261-431) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygs

SCOPe Domain Coordinates for d2c0uc1:

Click to download the PDB-style file with coordinates for d2c0uc1.
(The format of our PDB-style files is described here.)

Timeline for d2c0uc1: