| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
| Protein Nitroalkane oxidase [140471] (1 species) |
| Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (2 PDB entries) Uniprot Q8X1D8 261-430 |
| Domain d2c0uc1: 2c0u C:261-431 [129611] Other proteins in same PDB: d2c0ua2, d2c0ub2, d2c0uc2, d2c0ud2 automated match to d2c0ua1 complexed with fad, nbt |
PDB Entry: 2c0u (more details), 2.2 Å
SCOPe Domain Sequences for d2c0uc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0uc1 a.29.3.1 (C:261-431) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygs
Timeline for d2c0uc1: