Lineage for d2c0ub1 (2c0u B:261-430)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912955Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 913056Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 913057Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)
  6. 913133Protein Nitroalkane oxidase [140471] (1 species)
  7. 913134Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries)
    Uniprot Q8X1D8 261-430
  8. 913142Domain d2c0ub1: 2c0u B:261-430 [129609]
    Other proteins in same PDB: d2c0ua2, d2c0ub2, d2c0uc2, d2c0ud2
    automatically matched to 2C0U A:261-430
    complexed with fad, nbt

Details for d2c0ub1

PDB Entry: 2c0u (more details), 2.2 Å

PDB Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover
PDB Compounds: (B:) nitroalkane oxidase

SCOPe Domain Sequences for d2c0ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ub1 a.29.3.1 (B:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatyg

SCOPe Domain Coordinates for d2c0ub1:

Click to download the PDB-style file with coordinates for d2c0ub1.
(The format of our PDB-style files is described here.)

Timeline for d2c0ub1: