Lineage for d2c0ua1 (2c0u A:261-430)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 639872Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 639873Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)
  6. 639947Protein Nitroalkane oxidase [140471] (1 species)
  7. 639948Species Fusarium oxysporum [TaxId:5507] [140472] (2 PDB entries)
  8. 639955Domain d2c0ua1: 2c0u A:261-430 [129607]
    Other proteins in same PDB: d2c0ua2, d2c0ub2, d2c0uc2, d2c0ud2
    complexed with fad, nbt

Details for d2c0ua1

PDB Entry: 2c0u (more details), 2.2 Å

PDB Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover
PDB Compounds: (A:) nitroalkane oxidase

SCOP Domain Sequences for d2c0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ua1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatyg

SCOP Domain Coordinates for d2c0ua1:

Click to download the PDB-style file with coordinates for d2c0ua1.
(The format of our PDB-style files is described here.)

Timeline for d2c0ua1: