Lineage for d2c0sa1 (2c0s A:1-57)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640053Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 640126Superfamily a.30.7: BAS1536-like [140500] (1 family) (S)
  5. 640127Family a.30.7.1: BAS1536-like [140501] (2 proteins)
    PfamB 015565
  6. 640132Protein Hypothetical protein BAS4809, C-terminal domain [140504] (1 species)
  7. 640133Species Bacillus anthracis [TaxId:1392] [140505] (1 PDB entry)
  8. 640134Domain d2c0sa1: 2c0s A:1-57 [129606]

Details for d2c0sa1

PDB Entry: 2c0s (more details)

PDB Description: nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
PDB Compounds: (A:) conserved domain protein

SCOP Domain Sequences for d2c0sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0sa1 a.30.7.1 (A:1-57) Hypothetical protein BAS4809, C-terminal domain {Bacillus anthracis [TaxId: 1392]}
mnvtklndrieakkkeliylvekygfthhkvisfsqeldrllnllielktkkkrysl

SCOP Domain Coordinates for d2c0sa1:

Click to download the PDB-style file with coordinates for d2c0sa1.
(The format of our PDB-style files is described here.)

Timeline for d2c0sa1: