SCOPe 2.08: Domain d2c0sa1: 2c0s A:1-57

Lineage for d2c0sa1 (2c0s A:1-57)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.7: BAS1536-like [140500] (1 family)
   automatically mapped to Pfam PF09388

5. Family a.30.7.1: BAS1536-like [140501] (3 proteins)
   PfamB PB015565

6. Protein Hypothetical protein BAS4809, C-terminal domain [140504] (1 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [140505] (1 PDB entry)
   Uniprot Q81XQ9 52-108

8. Domain d2c0sa1: 2c0s A:1-57 [129606]
   Other proteins in same PDB: d2c0sa2

Details for d2c0sa1

PDB Entry: 2c0s

PDB Description: nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis

PDB Compounds: (A:) conserved domain protein

SCOPe Domain Sequences for d2c0sa1:

Sequence; same for both SEQRES and ATOM records:

>d2c0sa1 a.30.7.1 (A:1-57) Hypothetical protein BAS4809, C-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mnvtklndrieakkkeliylvekygfthhkvisfsqeldrllnllielktkkkrysl

Timeline for d2c0sa1:

• d2c0sa1 first appeared in SCOP 1.73
  
• d2c0sa1 appears in SCOPe 2.07