Lineage for d2c0ra1 (2c0r A:2-362)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705854Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 706023Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 706045Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [53427] (3 PDB entries)
  8. 706046Domain d2c0ra1: 2c0r A:2-362 [129604]
    automatically matched to d1bt4a_
    complexed with plp; mutant

Details for d2c0ra1

PDB Entry: 2c0r (more details), 1.2 Å

PDB Description: crystal structure of phosphoserine aminotransferase from bacillus circulans var. alkalophilus at ph 8.5
PDB Compounds: (A:) phosphoserine aminotransferase

SCOP Domain Sequences for d2c0ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]}
seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllal
lgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaa
sseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsr
pfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpp
sfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnit
frlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsr
g

SCOP Domain Coordinates for d2c0ra1:

Click to download the PDB-style file with coordinates for d2c0ra1.
(The format of our PDB-style files is described here.)

Timeline for d2c0ra1: