Lineage for d2c0mb1 (2c0m B:284-602)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647284Superfamily a.118.8: TPR-like [48452] (4 families) (S)
  5. 647285Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 647333Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)
  7. 647334Species Human (Homo sapiens) [TaxId:9606] [48463] (3 PDB entries)
  8. 647338Domain d2c0mb1: 2c0m B:284-602 [129597]
    automatically matched to d1fcha_

Details for d2c0mb1

PDB Entry: 2c0m (more details), 2.5 Å

PDB Description: apo form of the tpr domain of the pex5p receptor
PDB Compounds: (B:) peroxisomal targeting signal 1 receptor

SCOP Domain Sequences for d2c0mb1:

Sequence, based on SEQRES records: (download)

>d2c0mb1 a.118.8.1 (B:284-602) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
dkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqa
eneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlv
tpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnl
sgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsry
nlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsday
gaadardlstlltmfglpq

Sequence, based on observed residues (ATOM records): (download)

>d2c0mb1 a.118.8.1 (B:284-602) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
dkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqa
eneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlv
tpdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsvrpndy
llwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreavehflea
lnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq

SCOP Domain Coordinates for d2c0mb1:

Click to download the PDB-style file with coordinates for d2c0mb1.
(The format of our PDB-style files is described here.)

Timeline for d2c0mb1: