Lineage for d2c0lb1 (2c0l B:22-143)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730949Fold d.106: Sterol carrier protein, SCP [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 730950Superfamily d.106.1: Sterol carrier protein, SCP [55718] (1 family) (S)
  5. 730951Family d.106.1.1: Sterol carrier protein, SCP [55719] (3 proteins)
    Pfam PF02036
  6. 730958Protein Sterol carrier protein 2 (SCP2) [55720] (3 species)
  7. 730959Species Human (Homo sapiens) [TaxId:9606] [55721] (2 PDB entries)
  8. 730960Domain d2c0lb1: 2c0l B:22-143 [129595]
    automatically matched to d1qnda_

Details for d2c0lb1

PDB Entry: 2c0l (more details), 2.3 Å

PDB Description: tpr domain of human pex5p in complex with human mscp2
PDB Compounds: (B:) nonspecific lipid-transfer protein

SCOP Domain Sequences for d2c0lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0lb1 d.106.1.1 (B:22-143) Sterol carrier protein 2 (SCP2) {Human (Homo sapiens) [TaxId: 9606]}
sasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgsv
lpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgna
kl

SCOP Domain Coordinates for d2c0lb1:

Click to download the PDB-style file with coordinates for d2c0lb1.
(The format of our PDB-style files is described here.)

Timeline for d2c0lb1: