SCOPe 2.08: Domain d2c0lb_: 2c0l B:

Lineage for d2c0lb_ (2c0l B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
   Pfam PF02036

6. Protein automated matches [190237] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187005] (3 PDB entries)

8. Domain d2c0lb_: 2c0l B: [129595]
   Other proteins in same PDB: d2c0la_
   automated match to d1qnda_

Details for d2c0lb_

PDB Entry: 2c0l, 2.3 Å

PDB Description: tpr domain of human pex5p in complex with human mscp2

PDB Compounds: (B:) nonspecific lipid-transfer protein

SCOPe Domain Sequences for d2c0lb_:

Sequence; same for both SEQRES and ATOM records:

>d2c0lb_ d.106.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgsv
lpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgna
kl

Timeline for d2c0lb_:

• d2c0lb_ first appeared in SCOP 1.73, called d2c0lb1
  
• d2c0lb_ appears in SCOPe 2.07