Lineage for d2c0lb_ (2c0l B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968249Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2968250Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2968251Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
    Pfam PF02036
  6. 2968265Protein automated matches [190237] (3 species)
    not a true protein
  7. 2968266Species Human (Homo sapiens) [TaxId:9606] [187005] (3 PDB entries)
  8. 2968269Domain d2c0lb_: 2c0l B: [129595]
    Other proteins in same PDB: d2c0la_
    automated match to d1qnda_

Details for d2c0lb_

PDB Entry: 2c0l (more details), 2.3 Å

PDB Description: tpr domain of human pex5p in complex with human mscp2
PDB Compounds: (B:) nonspecific lipid-transfer protein

SCOPe Domain Sequences for d2c0lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0lb_ d.106.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgsv
lpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgna
kl

SCOPe Domain Coordinates for d2c0lb_:

Click to download the PDB-style file with coordinates for d2c0lb_.
(The format of our PDB-style files is described here.)

Timeline for d2c0lb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c0la_