Lineage for d2c0ha1 (2c0h A:18-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830897Protein endo-1,4-beta-mannosidase [141781] (1 species)
  7. 2830898Species Blue mussel (Mytilus edulis) [TaxId:6550] [141782] (1 PDB entry)
    Uniprot Q8WPJ2 18-367
  8. 2830899Domain d2c0ha1: 2c0h A:18-367 [129594]
    complexed with so4

Details for d2c0ha1

PDB Entry: 2c0h (more details), 1.6 Å

PDB Description: x-ray structure of beta-mannanase from blue mussel mytilus edulis
PDB Compounds: (A:) mannan endo-1,4-beta-mannosidase

SCOPe Domain Sequences for d2c0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]}
rlsvsgtnlnynghhiflsganqawvnyardfghnqyskgkstfestlsdmqshggnsvr
vwlhiegestpefdnngyvtgidntlisdmraylhaaqrhnilifftlwngavkqsthyr
lnglmvdtrklqsyidhalkpmanalknekalggwdimnepegeikpgesssepcfdtrh
lsgsgagwaghlysaqeigrfvnwqaaaikevdpgamvtvgswnmkadtdamgfhnlysd
hclvkaggkqsgtlsfyqvhtydwqnhfgnespfkhsfsnfrlkkpmvigefnqehgagm
ssesmfewaytkgysgawtwsrtdvswnnqlrgmqhlksrtdhgqvqfgl

SCOPe Domain Coordinates for d2c0ha1:

Click to download the PDB-style file with coordinates for d2c0ha1.
(The format of our PDB-style files is described here.)

Timeline for d2c0ha1: