Lineage for d2c0gb2 (2c0g B:1024-1145)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485304Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins)
    automatically mapped to Pfam PF07912
  6. 2485312Protein automated matches [254497] (1 species)
    not a true protein
  7. 2485313Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255077] (4 PDB entries)
  8. 2485315Domain d2c0gb2: 2c0g B:1024-1145 [129593]
    Other proteins in same PDB: d2c0ga1, d2c0gb1
    automated match to d1ovna2
    complexed with cl, na; mutant

Details for d2c0gb2

PDB Entry: 2c0g (more details), 1.75 Å

PDB Description: Structure of PDI-related Chaperone, Wind mutant-Y53S
PDB Compounds: (B:) windbeutel protein

SCOPe Domain Sequences for d2c0gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0gb2 c.47.1.7 (B:1024-1145) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctgcvdldelsfektverfpysvvkfdiaspygekheaftafsksahkatkdlliatvgv
kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
ig

SCOPe Domain Coordinates for d2c0gb2:

Click to download the PDB-style file with coordinates for d2c0gb2.
(The format of our PDB-style files is described here.)

Timeline for d2c0gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0gb1