Lineage for d2c0gb1 (2c0g B:1146-1244)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772087Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 772088Superfamily a.71.1: ERP29 C domain-like [47933] (1 family) (S)
  5. 772089Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins)
  6. 772093Protein Windbeutel, C-terminal domain [101269] (1 species)
  7. 772094Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries)
  8. 772096Domain d2c0gb1: 2c0g B:1146-1244 [129592]
    Other proteins in same PDB: d2c0ga2, d2c0gb2
    automatically matched to d1ovna1
    complexed with cl, na; mutant

Details for d2c0gb1

PDB Entry: 2c0g (more details), 1.75 Å

PDB Description: Structure of PDI-related Chaperone, Wind mutant-Y53S
PDB Compounds: (B:) windbeutel protein

SCOP Domain Sequences for d2c0gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0gb1 a.71.1.1 (B:1146-1244) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrv

SCOP Domain Coordinates for d2c0gb1:

Click to download the PDB-style file with coordinates for d2c0gb1.
(The format of our PDB-style files is described here.)

Timeline for d2c0gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0gb2