Lineage for d2c0ga1 (2c0g A:1146-1251)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330885Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 2330886Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) (S)
    automatically mapped to Pfam PF07749
  5. 2330900Family a.71.1.0: automated matches [254218] (1 protein)
    not a true family
  6. 2330901Protein automated matches [254498] (1 species)
    not a true protein
  7. 2330902Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255078] (4 PDB entries)
  8. 2330903Domain d2c0ga1: 2c0g A:1146-1251 [129590]
    Other proteins in same PDB: d2c0ga2, d2c0gb2
    automated match to d1ovna1
    complexed with cl, na; mutant

Details for d2c0ga1

PDB Entry: 2c0g (more details), 1.75 Å

PDB Description: Structure of PDI-related Chaperone, Wind mutant-Y53S
PDB Compounds: (A:) windbeutel protein

SCOPe Domain Sequences for d2c0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ga1 a.71.1.0 (A:1146-1251) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta

SCOPe Domain Coordinates for d2c0ga1:

Click to download the PDB-style file with coordinates for d2c0ga1.
(The format of our PDB-style files is described here.)

Timeline for d2c0ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0ga2