Lineage for d2c0fb1 (2c0f B:146-245)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003134Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 2003135Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) (S)
    automatically mapped to Pfam PF07749
  5. 2003149Family a.71.1.0: automated matches [254218] (1 protein)
    not a true family
  6. 2003150Protein automated matches [254498] (1 species)
    not a true protein
  7. 2003151Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255078] (4 PDB entries)
  8. 2003155Domain d2c0fb1: 2c0f B:146-245 [129588]
    Other proteins in same PDB: d2c0fa2, d2c0fb2
    automated match to d1ovna1
    mutant

Details for d2c0fb1

PDB Entry: 2c0f (more details), 2.28 Å

PDB Description: Structure of Wind Y53F mutant
PDB Compounds: (B:) windbeutel protein

SCOPe Domain Sequences for d2c0fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0fb1 a.71.1.0 (B:146-245) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvh

SCOPe Domain Coordinates for d2c0fb1:

Click to download the PDB-style file with coordinates for d2c0fb1.
(The format of our PDB-style files is described here.)

Timeline for d2c0fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0fb2