SCOPe 2.04: Domain d2c0fb1: 2c0f B:146-245

Lineage for d2c0fb1 (2c0f B:146-245)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.1: ERP29 C domain-like [47933] (2 families)
   automatically mapped to Pfam PF07749

5. Family a.71.1.0: automated matches [254218] (1 protein)
   not a true family

6. Protein automated matches [254498] (1 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255078] (4 PDB entries)

8. Domain d2c0fb1: 2c0f B:146-245 [129588]
   Other proteins in same PDB: d2c0fa2, d2c0fb2
   automated match to d1ovna1
   mutant

Details for d2c0fb1

PDB Entry: 2c0f, 2.28 Å

PDB Description: Structure of Wind Y53F mutant

PDB Compounds: (B:) windbeutel protein

SCOPe Domain Sequences for d2c0fb1:

Sequence; same for both SEQRES and ATOM records:

>d2c0fb1 a.71.1.0 (B:146-245) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvh

Timeline for d2c0fb1:

• d2c0fb1 first appeared in SCOP 1.73
  
• d2c0fb1 appears in SCOPe 2.03
  
• d2c0fb1 appears in SCOPe 2.05
  
• d2c0fb1 appears in the current release, SCOPe 2.08