Class a: All alpha proteins [46456] (284 folds) |
Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
Superfamily a.71.1: ERP29 C domain-like [47933] (1 family) |
Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins) |
Protein Windbeutel, C-terminal domain [101269] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries) |
Domain d2c0fb1: 2c0f B:146-245 [129588] Other proteins in same PDB: d2c0fa2, d2c0fb2 automatically matched to d1ovna1 mutant |
PDB Entry: 2c0f (more details), 2.28 Å
SCOPe Domain Sequences for d2c0fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0fb1 a.71.1.1 (B:146-245) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg ydfleeetkrllrlkagkvteakkeellrklnilevfrvh
Timeline for d2c0fb1: