Lineage for d2c0fb1 (2c0f B:146-245)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643952Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 643953Superfamily a.71.1: ERP29 C domain-like [47933] (1 family) (S)
  5. 643954Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins)
  6. 643958Protein Windbeutel, C-terminal domain [101269] (1 species)
  7. 643959Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (5 PDB entries)
  8. 643965Domain d2c0fb1: 2c0f B:146-245 [129588]
    Other proteins in same PDB: d2c0fa2, d2c0fb2
    automatically matched to d1ovna1
    mutant

Details for d2c0fb1

PDB Entry: 2c0f (more details), 2.28 Å

PDB Description: Structure of Wind Y53F mutant
PDB Compounds: (B:) windbeutel protein

SCOP Domain Sequences for d2c0fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0fb1 a.71.1.1 (B:146-245) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvh

SCOP Domain Coordinates for d2c0fb1:

Click to download the PDB-style file with coordinates for d2c0fb1.
(The format of our PDB-style files is described here.)

Timeline for d2c0fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0fb2