Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins) automatically mapped to Pfam PF07912 |
Protein automated matches [254497] (1 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255077] (4 PDB entries) |
Domain d2c0fa2: 2c0f A:24-145 [129587] Other proteins in same PDB: d2c0fa1, d2c0fb1 automated match to d1ovna2 mutant |
PDB Entry: 2c0f (more details), 2.28 Å
SCOPe Domain Sequences for d2c0fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0fa2 c.47.1.7 (A:24-145) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ctgcvdldelsfektverfpysvvkfdiafpygekheaftafsksahkatkdlliatvgv kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply ig
Timeline for d2c0fa2: